PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462962559
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family bZIP
Protein Properties Length: 855aa    MW: 92096.1 Da    PI: 8.9066
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462962559genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.92.4e-14240302163
                XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                e e kr  r+ +NRe+A  sRqRKk+++eeLe kvk+++a   +L  +++  + e a+lk+++
  462962559 240 EDEAKRRARLVRNRESAHLSRQRKKQYVEELEGKVKAMQATIADLSARISCVTAENAALKQQL 302
                5789********************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.1E-14240304IPR004827Basic-leucine zipper domain
PfamPF001709.5E-13240302IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.151242302IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-16244302No hitNo description
SuperFamilySSF579598.13E-13244302No hitNo description
CDDcd147041.57E-20245296No hitNo description
Gene3DG3DSA:3.10.20.903.6E-14760837No hitNo description
SuperFamilySSF542361.43E-14760839IPR029071Ubiquitin-related domain
PROSITE profilePS5005314.251762838IPR000626Ubiquitin domain
SMARTSM002131.2E-9762834IPR000626Ubiquitin domain
PfamPF002402.1E-9764835IPR000626Ubiquitin domain
CDDcd017692.39E-7767834No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 855 aa     Download sequence    Send to blast
MNDTGIATDV SSRVDTAVLP SRRSLRRRGE LPAPPAGDPS RQEAAGCDRR HCQVKAAQGR  60
CVRLRPSHAA AHAGSSPPRR LINPTDSVRR PNPPVLFPFY VGNPARFRNR VRNPNCLRRR  120
SVAEPSLLAP VAQDPFADLP FPDFQAPPVD DTFAFEDFDL DDLDLDVDFD LDLFAPDGQL  180
SPPPPPLVTS SSSAASPERG SSSSGAGADG GLRNEESSES SSRSATGQDS RCKEKGDGPE  240
DEAKRRARLV RNRESAHLSR QRKKQYVEEL EGKVKAMQAT IADLSARISC VTAENAALKQ  300
QLGGAAGGAP PPMPMYPAVY PLPMPWVHPA YAMRGSQVPL VPIPRLKPQQ PAPAAAEPPA  360
KKARKTKKVA SVSLLGLLCL LMVSGCLIPA VNRMYGAVDT GEGAAFGPSH HGRVLAVEGP  420
RSSVGEGIDP KPPQNASESL PALLYLPRNG KHVKINGNLV IKSIVASEKA SSRVPSYDGK  480
ILGSQGNEET SLAIPGYVAP LKAGEVMEST TETKNKLMAL VPGDGKIYRD DDGLLPQWFS  540
EAMSGPMLSS GMCTEVFQFD VSSTHSNGIV PVYSNAMSNS SQNFTENLPA GRRQKVNRRI  600
LYNEAIPLQG STPNDTEHLK AHPKNESYAR SKPVSSVVVS VLADPREAGD GNNEGRISSK  660
SLSRIFVVVL IDSPMGPSFR MWPSGSLPKV QAYRQGPSAK VDDGGVPHPS SPTDLRRSVF  720
VCLPSRLGVP LVRTSAGSPV DFAERREAAG TAHTGFWQVS SMYIRVKRNK NTYFIQCEPT  780
ETALNIKQKL HSLIDQPPSN QKLVLLATND VLEDSKTLAD QKVENDAVVA LALRKDDNGF  840
EDVFIARPED FMSSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2456400.0KF245640.1 Eleusine coracana cultivar MR1 bZIP transcription factor a mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002461117.10.0hypothetical protein SORBIDRAFT_02g041070
TrEMBLA0A0K0K9Y80.0A0A0K0K9Y8_ELECO; BZIP transcription factor a
STRINGSb02g041070.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.12e-61bZIP family protein